PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100040870191
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 289aa    MW: 31770.4 Da    PI: 6.5135
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100040870191genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.24.3e-343892155
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  kprlrWt +LHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Ote100040870191|100040870191 38 KPRLRWTADLHERFVDAVTQLGGADKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 92
                                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6663595IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-333692IPR009057Homeodomain-like
SuperFamilySSF466891.09E-163792IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-243893IPR006447Myb domain, plants
PfamPF002495.0E-84091IPR001005SANT/Myb domain
PfamPF143794.3E-26131176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MYSALPLHTL AVEPDFQGSL DGTNLPGDAC LILSTDPKPR LRWTADLHER FVDAVTQLGG  60
ADKATPKTIM RTMGVKGLTL YHLKSHLQKY RLGKLASSKD LTEISKDEEW YKPFILFTIT  120
LAVQVEIDAL VTEALRVQME VQRKLHEQLE VQRHLQIRIE AQSKYLQSIL DKACKALDDE  180
AAASAGLEVA RKELSVLAIK VANDCNGVLS VPPSSHIHNE SDNDTNSIPY MPARLGECSI  240
DSGAMSNGSP ISPSTLESQA AAMKKRPRPL FSGGDGSMRP VEWMMSNFG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091432.11e-133PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK51e-57APL_ARATH; Myb family transcription factor APL
TrEMBLA0A068TU041e-122A0A068TU04_COFCA; Uncharacterized protein
STRINGVIT_05s0029g00060.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344